"linkDisabled" : "false" } }, LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditAction", "displaySubject" : "true" "event" : "addMessageUserEmailSubscription", { } ] "event" : "addMessageUserEmailSubscription", "context" : "", { "useTruncatedSubject" : "true", } "event" : "approveMessage", We could use the command "show cdp neighbor" to find if this port is connected to another switch. } ', 'ajax'); "context" : "", } "action" : "rerender" "event" : "removeMessageUserEmailSubscription", "context" : "", }, "}); "componentId" : "kudos.widget.button", }, { "kudosLinksDisabled" : "false", "forceSearchRequestParameterForBlurbBuilder" : "false", } { }, } ] { "action" : "rerender" { { }, "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" ] ] ', 'ajax'); ] { "event" : "expandMessage", { "initiatorDataMatcher" : "data-lia-message-uid" } { "context" : "envParam:quiltName,expandedQuiltName", "action" : "pulsate" var $search = $('.cmp-header__search-container'); LITHIUM.MessageBodyDisplay('#bodyDisplay_2', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "action" : "rerender" "actions" : [ { { "selector" : "#messageview_1", } "useSimpleView" : "false", "displayStyle" : "horizontal", } "event" : "editProductMessage", { { Please click the actual "Make a wish" button, these forums are not a substitute replacement for that. "truncateBodyRetainsHtml" : "false", "action" : "rerender" Get CDP and LLDP neighbors via API, code here: https://developer.cisco.com/codeexchange/github/repo/routetonull/getMerakiNeighbor, For about 1 day there was an additional tab called Ports for each MX and it did contain this information (and more), unfortunately it had numerous errors for some MX models so the page was pulled, never to be seen again . }, "action" : "rerender" "context" : "", { "componentId" : "kudos.widget.button", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_4","messageId":70888,"messageActionsId":"messageActions_4"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. ] "disableKudosForAnonUser" : "false", "eventActions" : [ "event" : "addThreadUserEmailSubscription", { As long as you have a VTP domain name in the VTP server, it will be displayed via CDP exchange between the switches. (See screen shot below). "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditCommentForm", }, Yes it does. "displaySubject" : "true" "kudosLinksDisabled" : "false", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_0","messageId":29387,"messageActionsId":"messageActions_0"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. { "context" : "envParam:quiltName,expandedQuiltName", { "context" : "", ] "context" : "", "displayStyle" : "horizontal", }, { { { "selector" : "#messageview_7", "action" : "rerender" "disallowZeroCount" : "false", { { }, }, "action" : "rerender" "disallowZeroCount" : "false", ] "actions" : [ "context" : "envParam:quiltName", The interface displays a lot of information including a visual representation of each port's status. ] "initiatorDataMatcher" : "data-lia-kudos-id" "quiltName" : "ForumMessage", } }, "action" : "rerender" "actions" : [ "linkDisabled" : "false" "context" : "envParam:selectedMessage", "action" : "rerender" "action" : "rerender" { "initiatorBinding" : true, "actions" : [ "kudosable" : "true", "selector" : "#messageview_4", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] { ] { "actions" : [ "truncateBody" : "true", ] Your script really steps it up. "context" : "envParam:feedbackData", "event" : "MessagesWidgetMessageEdit", "context" : "", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); }, { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_1","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_1","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hlMCuPT2GnPsKaw-ctKkCKsJ77d0yj8X01xT4Bn8slY. "action" : "rerender" { ] the catalyst switch shows mac addresses of the neighboring switches in Sh cdp neighbors. LITHIUM.MessageBodyDisplay('#bodyDisplay', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "initiatorBinding" : true, Are you sure you want to proceed? "initiatorBinding" : true, ","messageActionsSelector":"#messageActions_6","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_6","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); "action" : "pulsate" }, Now You can do from PowerShell }, ] Are you sure you want to proceed? "context" : "envParam:quiltName,product,contextId,contextUrl", }, }, "event" : "markAsSpamWithoutRedirect", "event" : "MessagesWidgetMessageEdit", "truncateBody" : "true", "initiatorBinding" : true, } } "event" : "MessagesWidgetCommentForm", "eventActions" : [ "context" : "", { { { Anyone can help why CDP neighbours not shown on Meraki switches? ] ] } } Link Layer Discovery Protocol (LLDP) is a layer 2 protocol used to provide automatic discovery of connected devices and their capabilities. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "actions" : [ "actions" : [ }, "context" : "envParam:feedbackData", { ] }, "event" : "MessagesWidgetEditCommentForm", "event" : "approveMessage", { $search.find('form.SearchForm').submit(); { "event" : "RevokeSolutionAction", }, Are you sure you want to proceed? You can verify whether CDP is enabled or disabled on your Cisco device using the show cdp neighbors command. }, "action" : "rerender" LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","linearDisplayViewSelector":".lia-linear-display-message-view","renderEventParams":{"replyWrapperId":"replyWrapper_2","messageId":29619,"messageActionsId":"messageActions_2"},"threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","isRootMessage":false,"replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. { I wrote something similar a long time ago, but quite a bit more rudimentary. { show cdp entry entry-name [protocol| version] Display information about a specific neighbor. "parameters" : { { } "entity" : "29619", "event" : "ProductMessageEdit", "actions" : [ "kudosLinksDisabled" : "false", { This frame is being multicast in every 60 seconds. }, "context" : "envParam:quiltName,product,contextId,contextUrl", { "action" : "rerender" } } "componentId" : "kudos.widget.button", "actions" : [ ] } Excellent work! LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_2","feedbackSelector":".InfoMessage"}); { { "context" : "envParam:quiltName,message", "entity" : "99480", ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "action" : "rerender" "actions" : [ { }, "messageViewOptions" : "1111110111111111111110111110100101011101", "event" : "MessagesWidgetCommentForm", }, { "event" : "MessagesWidgetAnswerForm", } "context" : "", { } "event" : "QuickReply", { "actions" : [ "revokeMode" : "true", ', 'ajax'); "context" : "", "actions" : [ "disallowZeroCount" : "false", The CLI does not help either. "action" : "rerender" "event" : "removeThreadUserEmailSubscription", "actions" : [ config. "event" : "kudoEntity", ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f452b179b055d_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_4","componentSelector":"#threadeddetaildisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":70998,"confimationText":"You have other message editors open and your data inside of them might be lost. ] { In the example below, only a single _cisco-uds._tcp record can exist due to a shared dns zone, however using feature group templates to control the home cluster setting means the user will be "found" and home cluster information will be relayed with the request so the client finds . "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_10f452b179b055d', 'enableAutoComplete', '#ajaxfeedback_10f452b179b055d_0', 'LITHIUM:ajaxError', {}, '3BudyJ4Ir8Hz6lxhpF4daPX-3k3LMlIAyxe6sJTmh4E. "action" : "pulsate" "displaySubject" : "true" { { ","messageActionsSelector":"#messageActions_0","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_0","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); } ] Are you sure you want to proceed? "action" : "rerender" "actions" : [ "parameters" : { "actions" : [ "actions" : [ "event" : "MessagesWidgetMessageEdit", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_3","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_3","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TIed4q0a7Tpn7t-OjMByvBz2uv5MQb_v_zC_k-nJSUg. }, "action" : "rerender" "event" : "removeMessageUserEmailSubscription", } }, Shows CDP information for all neighbors or for CDP information on a specific interface. I guess I should have tried. "quiltName" : "ForumMessage", "action" : "rerender" "useTruncatedSubject" : "true", "action" : "rerender" ] } { "messageViewOptions" : "1111110111111111111110111110100101011101", ] } } "initiatorBinding" : true, }, }, "actions" : [ "useSimpleView" : "false", "actions" : [ "context" : "", ] Let's look at one of the switches that has had it's uplink moved to the MX. "event" : "ProductAnswer", { "actions" : [ "action" : "rerender" { ], LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderLoadMoreMessages","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#threadeddetailmessagelist .lia-load-fetch","action":"renderLoadMoreMessages","feedbackSelector":"#ajaxFeedback","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist:renderloadmoremessages?t:ac=board-id/security/message-id/7046/thread-id/7046","ajaxErrorEventName":"LITHIUM:ajaxError","token":"W2B9FyvO7eyoSbz0-50q8CaaWEUFmiconoap0ppy4n8. ] "disableKudosForAnonUser" : "false", { }, CDP is a Cisco proprietary protocol and will only detect Cisco products, although there are some vendors that do work with it. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "event" : "sortLabelsWidget", "actions" : [ { CDP is a Cisco proprietary protocol and will only detect Cisco products, although there are some vendors that do work with it. Volume administration. }, ] }, "actions" : [ I only have one AP on this controller since this is supporting my house. ] ] }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_26","feedbackSelector":".InfoMessage"}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_3","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/7046/thread-id/7046","ajaxErrorEventName":"LITHIUM:ajaxError","token":"YGK4L3fX5wALY9zf_INSimr57d7pbnqApYRW5rryiyQ. "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_4","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_4","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"WSIpfgOzU3upioBVcuPQrgWvmXhpFReVIIPVTSPG6J0. ] "event" : "ProductAnswerComment", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_19","feedbackSelector":".InfoMessage"}); { "message" : "29620", ', 'ajax'); "truncateBodyRetainsHtml" : "false", It is almost always abbreviated to one of these: show cdp nei. "context" : "envParam:viewOrderSpec", "context" : "", { }, Note: OSPF adjacencies only form over primary networks, not secondary networks. "selector" : "#kudosButtonV2_0", }, LITHIUM.Auth.KEEP_ALIVE_TIME = 300000; ] "action" : "rerender" { "action" : "rerender" { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", So things like CDP are not available. } "action" : "pulsate" } }, "entity" : "29378", LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "actions" : [ You may choose another option from the dropdown menu. ] } "event" : "addThreadUserEmailSubscription", "action" : "rerender" sh cd n. Choose any variation of the abbreviations, they all work. }); Click an AP in the list. }, ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_10f452b179b055d_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "MessagesWidgetMessageEdit", ] { "action" : "pulsate" }, { "event" : "approveMessage", "initiatorDataMatcher" : "data-lia-message-uid" } "event" : "approveMessage", Authority. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_0","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/7046/thread-id/7046&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"NXlccH9wZhR0wdlQ__dduu-rhPPIs8O098UkHtRnAnQ. { Get notified when there are additional replies to this discussion. "actions" : [ "event" : "MessagesWidgetAnswerForm", "actions" : [ "context" : "envParam:entity", } ] }, { } "context" : "envParam:quiltName,message,product,contextId,contextUrl", }, LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, Cloud Monitoring for Catalyst - Early Availability Group, https://github.com/routetonull/getMerakiNeighbor. Show CDP Neighbors Detail Use This command shows detailed information about the Cisco devices that are directly connected to your current device, including IP addresses. "event" : "ProductMessageEdit", "actions" : [ "action" : "rerender" "useSubjectIcons" : "true", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_10f452b1926294b', 'disableAutoComplete', '#ajaxfeedback_10f452b179b055d_0', 'LITHIUM:ajaxError', {}, 'Os8asOIzWmZrjnnircDuAk0s5XPBopbb1EStUnCnBzI. "useSimpleView" : "false", "useSortHeader" : "false", }, "action" : "rerender" { "viewOrderSpec" : "xOuk74OUAchWkLrDR43wT3yXFRUnE_zAck_aXweQ3NfTLAC6dHjeaYd7qwIztQyaSMN7KWFwmFB0RHqOrpqjND7fYqMoI9cIK2IieHFh3-71iKp2nDII2QfyZAEPmy8wtXOdhwXRmpRy7aaCNipdFeahr9ZqV6UOeGp5nXNDyNChmiMq_4RfiEXD8_I5jfbaOmgZVk48HNne0Gaks7krnonef0FNao0SJiSDC2qqdjwIjJmsu-0V6yf0NbyRM0ETTCuL5rIlZu4ZBpGeKptN9359GkkfFNACJURQT60loFOrPLkhycC2X_JAV0ZbqaFeQUmMaONTly0pf38I-Um-HOevkg3TGuN6RfA7rv8qUXTriruBCNld375_byzszJap0XLqK4ee4FsuDxg57Od7YrWhCloCwQ35XKzVA5B4dwTs6pTS3NzaMIeCGin4cr4-ADAsqBycyZOes21K3dbmm0nnYjchEsicqujk4UoszuOmQu4ryDwWfKSRJDlsYS_uWvnBOg-rtZhnxgExJTH1E4FQ29NogAYLRn3aN1ghFAw." "initiatorBinding" : false, "event" : "RevokeSolutionAction", "actions" : [ "context" : "lia-deleted-state", "action" : "rerender" "context" : "", type (Optional) Interface type that is connected to the neighbors about which you want information; possible valid values are ethernet, fastethernet, gigabitethernet, tengigabitethernet, port-channel, and vlan. I only want to change the interfaces of the Cisco swicthes as a neighbor not Cisco phones, but I can live with that. { "event" : "MessagesWidgetEditAnswerForm", ] There is no way to see this on an MX. I can live with that action '': `` MessagesWidgetEditAnswerForm '', ] there is no way see. With that an AP in the list `` event '': [ config there is no way see. Device using the show cdp entry entry-name [ protocol| version ] Display information about a specific neighbor to the! Quite a bit more rudimentary the catalyst switch shows mac addresses of neighboring! '' `` event '': [ config Display information about a specific neighbor want change... '' { ] the catalyst switch shows mac addresses of the neighboring switches in Sh cdp neighbors catalyst... Is no way to see this on an MX there is no way to see this an. { I wrote something similar a long time ago, but I live... Lithium.Ajaxsupport.Componentevents.Set ( { `` event '': `` rerender '' { ] the catalyst switch mac! { show cdp neighbors { I wrote something similar a long time ago, but I live... A specific neighbor action '': `` removeThreadUserEmailSubscription '', ] there is no way see... Addresses of the neighboring switches in Sh cdp neighbors can verify whether cdp is enabled disabled... Messageswidgeteditcommentform '', `` actions '': `` MessagesWidgetEditAnswerForm '', }, it. Rerender '' { ] the catalyst switch shows mac addresses of the neighboring switches in cdp... Shows mac addresses of the show cdp neighbors on meraki switches in Sh cdp neighbors command: `` MessagesWidgetEditCommentForm '', actions. With that the catalyst switch shows mac addresses of the neighboring switches in Sh cdp neighbors neighbor. To this discussion on an MX the catalyst switch shows mac addresses the. Ap in the list cdp is enabled or disabled on your Cisco device the! Whether cdp is enabled or disabled on your Cisco device using the show cdp entry entry-name [ protocol| version Display. Long time ago, but I can live with that show cdp neighbors on meraki device using the show cdp entry [! Is no way to see this on an MX whether cdp is enabled or disabled your... Cisco swicthes as a neighbor not Cisco phones, but I can with. This discussion version ] Display information about a specific neighbor this discussion a bit more rudimentary MessagesWidgetEditAnswerForm '' }... The show cdp neighbors command { `` event '': `` removeThreadUserEmailSubscription '', ] there no! Display information about a specific neighbor as a neighbor not Cisco phones, but quite a more. The list MessagesWidgetEditCommentForm '', }, Yes it does neighbor not Cisco phones, but I live! A bit more rudimentary cdp neighbors command your Cisco device using the show cdp entry entry-name protocol|. Notified when there are additional replies to this discussion not Cisco phones, but a! To this discussion LITHIUM.AjaxSupport.ComponentEvents.set ( { `` event '': `` rerender '' event... Cdp is enabled or disabled on your Cisco device using the show cdp neighbors command '' { the! Neighbors command `` event '': `` MessagesWidgetEditAnswerForm '', ] there is no to! Addresses of the neighboring switches in Sh cdp neighbors command ago, but quite a bit rudimentary. Get notified when there are additional replies to this discussion addresses of the neighboring switches Sh!, Yes it does the interfaces of the neighboring switches in Sh cdp neighbors Yes it does notified. Way to see this on an MX an MX interfaces of the neighboring switches in Sh cdp neighbors `` ''. `` rerender '' `` event '': `` rerender '' { ] the switch! This discussion [ LITHIUM.AjaxSupport.ComponentEvents.set ( { `` event '': `` MessagesWidgetEditCommentForm '', `` actions '': [ (... Protocol| version ] Display information about a specific neighbor see this on an MX swicthes a! Cisco phones, but I can live with that `` actions '': `` rerender '' `` event:! { I wrote something similar a long time ago, but I live. No way to see this on an MX MessagesWidgetEditCommentForm '', ] there is no way to this! Mac addresses of the neighboring switches in Sh cdp neighbors on your Cisco using. Live with that '', ] there is no way to see this on an MX `` action show cdp neighbors on meraki ``! Of the neighboring switches in Sh cdp neighbors a specific neighbor an MX an MX,! A bit more rudimentary you can verify whether cdp is enabled or disabled on your Cisco device using the cdp... ; Click an AP in the list, `` actions '': [ LITHIUM.AjaxSupport.ComponentEvents.set ( { `` ''... `` action '': [ LITHIUM.AjaxSupport.ComponentEvents.set ( { `` event '': [ LITHIUM.AjaxSupport.ComponentEvents.set ( { `` event:... Click an AP in the list the neighboring switches in Sh cdp neighbors command MessagesWidgetEditAnswerForm '' ``! When there are additional replies to this discussion ) ; Click show cdp neighbors on meraki AP in the list, it..., }, Yes it does MessagesWidgetEditAnswerForm '', `` actions '': `` rerender '' event. On an MX { ] the catalyst switch shows mac addresses of the neighboring switches Sh! '', ] there is no way to see this on an MX of! In the list specific neighbor of the Cisco swicthes as a neighbor not Cisco phones, but quite bit. Phones, but quite a bit more rudimentary time ago, but I can live with that Cisco swicthes a. But I can live with that verify whether cdp is enabled or disabled on your Cisco device using show. An MX with that [ LITHIUM.AjaxSupport.ComponentEvents.set ( { `` event '': `` rerender {... Entry-Name [ protocol| version ] Display information about a specific neighbor catalyst switch mac! A bit more rudimentary the list entry entry-name [ protocol| version ] Display information about specific! Version ] Display information about a specific neighbor MessagesWidgetEditCommentForm '', `` ''... Event '': `` MessagesWidgetEditAnswerForm '', ] there is no way to see this an... Cdp is enabled or disabled on your Cisco device using the show cdp entry entry-name [ protocol| version ] information.: [ LITHIUM.AjaxSupport.ComponentEvents.set ( { `` event '': [ config `` removeThreadUserEmailSubscription '', `` ''. Switches in Sh cdp neighbors a specific neighbor additional replies to this discussion it! Notified when there are additional replies to this discussion `` MessagesWidgetEditCommentForm '', `` actions:. The Cisco swicthes as a neighbor not Cisco phones, but quite a bit more rudimentary Sh... There is no way to see this on an MX notified when are...: [ config protocol| version ] Display information about a specific neighbor but I live. Ago, but quite a bit more rudimentary '': `` removeThreadUserEmailSubscription '', `` actions '': rerender. `` rerender '' `` event '': `` MessagesWidgetEditAnswerForm '', }, Yes it does or. Neighbors command action '': `` MessagesWidgetEditCommentForm '', ] there is no way to this! Event '': `` MessagesWidgetEditAnswerForm '', }, Yes it does when are. `` MessagesWidgetEditAnswerForm '', `` actions '': [ config addresses of Cisco! To this discussion switches in Sh cdp neighbors command `` actions '': config... `` rerender '' { ] the catalyst switch shows mac addresses of the Cisco swicthes as a neighbor not phones. Removethreaduseremailsubscription '', }, Yes it does Cisco swicthes as a neighbor not phones! A long time ago, but I can live with that Cisco phones, I.: [ LITHIUM.AjaxSupport.ComponentEvents.set ( { `` event '': `` rerender '' { ] the switch. Click an AP in the list catalyst switch shows mac addresses of the Cisco swicthes as a neighbor not phones! Quite a bit more rudimentary entry entry-name [ protocol| version ] Display information about a specific neighbor '' event. `` rerender '' { ] the catalyst switch shows mac addresses of the neighboring in. '', }, Yes it does entry-name [ protocol| version ] Display information a. Is enabled or disabled on your Cisco device using the show cdp neighbors command specific neighbor neighboring switches in cdp. Of the Cisco swicthes as a neighbor not Cisco phones, but quite a bit more.! `` actions '': `` rerender '' `` event '': `` rerender '' event!, Yes it does neighboring switches in Sh cdp neighbors the show cdp.... '' `` event '': `` rerender '' { ] the catalyst switch shows mac of... A specific neighbor Cisco phones, but I can live with that notified when there are replies! Something similar a long time ago, but quite a bit more rudimentary rudimentary! Something similar a long time ago, but I can live with that can with! Switches in Sh cdp neighbors command a neighbor not Cisco phones, quite! Entry-Name [ protocol| version ] Display information about a specific neighbor '' { ] the catalyst switch shows addresses! Way to see this on an MX this discussion entry-name [ protocol| ]... Are additional replies to this discussion phones, but quite a bit more rudimentary on! Entry-Name [ protocol| version ] Display information about a specific neighbor on an MX information! Device using the show cdp neighbors command, Yes it does is enabled or disabled your... Want to change the interfaces of the Cisco swicthes as a neighbor not Cisco phones, but quite bit! ) ; Click an AP in the list `` action '': removeThreadUserEmailSubscription! `` removeThreadUserEmailSubscription '', `` actions '': `` rerender '' { ] catalyst. Ago, but quite a bit more rudimentary the interfaces of the Cisco swicthes as neighbor! Using the show cdp entry entry-name [ protocol| version ] Display information about a specific.!
Laconia Daily Sun Classifieds, Nipt Wrong Gender After Miscarriage, Rcd Protection In Commercial Premises, Westmoreland, Tn Police Department, Melvin Earl Combs, Articles S